A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10445
Swiss-prot Accession number	P19209 (Sequence in FASTA format)
Description	Somatostatin precursor [Contains: Somatostatin-34; Somatostatin-14](Fragment).
Source organism	Myxine glutinosa (Atlantic hagfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Hyperotreti; Myxiniformes;Myxinidae; Myxininae; Myxine.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatostatin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Somatostatin inhibits the release of somatotropin
Protein Length	34 Amino acids
Molecular weight	3963
References	1  PubMed abstract 2896118
Domain Name	Somatostatin
Hormone Name	Somatostatin-34
Mature Hormone Sequence	AVERPRQDGQVHEPPGRERKAGCKNFFWKTFTSC
Position of mature hormone in Pre-Hormone protein	34 Residues from position (1-34)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10863
Swiss-prot Accession number	P01342 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Myxine glutinosa (Atlantic hagfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Hyperotreti; Myxiniformes;Myxinidae; Myxininae; Myxine.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	115 Amino acids
Molecular weight	12615
References	1  PubMed abstract 6265453 2  PubMed abstract 1097441 3  PubMed abstract 4418746 4  PubMed abstract 4427361
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	RTTGHLCGKDLVNALYIACGVRGFFYDPTKM
Position of mature hormone in Pre-Hormone protein	30 Residues from position (27-57)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	10864
Swiss-prot Accession number	P01342 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Myxine glutinosa (Atlantic hagfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Hyperotreti; Myxiniformes;Myxinidae; Myxininae; Myxine.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	115 Amino acids
Molecular weight	12615
References	1  PubMed abstract 6265453 2  PubMed abstract 1097441 3  PubMed abstract 4418746 4  PubMed abstract 4427361
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCHKRCSIYDLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (95-115)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 4

HMRbase accession number	11144
Swiss-prot Accession number	P19209 (Sequence in FASTA format)
Description	Somatostatin precursor [Contains: Somatostatin-34; Somatostatin-14](Fragment).
Source organism	Myxine glutinosa (Atlantic hagfish)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Hyperotreti; Myxiniformes;Myxinidae; Myxininae; Myxine.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatostatin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Somatostatin inhibits the release of somatotropin
Protein Length	34 Amino acids
Molecular weight	3963
References	1  PubMed abstract 2896118
Domain Name	Somatostatin
Hormone Name	Somatostatin-14
Mature Hormone Sequence	AGCKNFFWKTFTSC
Position of mature hormone in Pre-Hormone protein	14 Residues from position (21-34)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated