A database of hormones and their receptors |
|
|
|
|
|
|
HMRbase accession number | 10445 |
Swiss-prot Accession number | P19209 (Sequence in FASTA format) |
Description | Somatostatin precursor [Contains: Somatostatin-34; Somatostatin-14](Fragment). |
Source organism | Myxine glutinosa (Atlantic hagfish) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Hyperotreti; Myxiniformes;Myxinidae; Myxininae; Myxine. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatostatin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Somatostatin inhibits the release of somatotropin |
Protein Length | 34 Amino acids |
Molecular weight | 3963 |
References | 1 PubMed abstract 2896118 |
Domain Name | Somatostatin |
Hormone Name | Somatostatin-34 |
Mature Hormone Sequence | AVERPRQDGQVHEPPGRERKAGCKNFFWKTFTSC |
Position of mature hormone in Pre-Hormone protein | 34 Residues from position (1-34) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10863 |
Swiss-prot Accession number | P01342 (Sequence in FASTA format) |
Description | Insulin precursor [Contains: Insulin B chain; Insulin A chain]. |
Source organism | Myxine glutinosa (Atlantic hagfish) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Hyperotreti; Myxiniformes;Myxinidae; Myxininae; Myxine. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver |
Protein Length | 115 Amino acids |
Molecular weight | 12615 |
References | 1 PubMed abstract 6265453 2 PubMed abstract 1097441 3 PubMed abstract 4418746 4 PubMed abstract 4427361 |
Domain Name | Insulin |
Hormone Name | Insulin B chain |
Mature Hormone Sequence | RTTGHLCGKDLVNALYIACGVRGFFYDPTKM |
Position of mature hormone in Pre-Hormone protein | 30 Residues from position (27-57) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 10864 |
Swiss-prot Accession number | P01342 (Sequence in FASTA format) |
Description | Insulin precursor [Contains: Insulin B chain; Insulin A chain]. |
Source organism | Myxine glutinosa (Atlantic hagfish) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Hyperotreti; Myxiniformes;Myxinidae; Myxininae; Myxine. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the insulin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver |
Protein Length | 115 Amino acids |
Molecular weight | 12615 |
References | 1 PubMed abstract 6265453 2 PubMed abstract 1097441 3 PubMed abstract 4418746 4 PubMed abstract 4427361 |
Domain Name | Insulin |
Hormone Name | Insulin A chain |
Mature Hormone Sequence | GIVEQCCHKRCSIYDLENYCN |
Position of mature hormone in Pre-Hormone protein | 21 Residues from position (95-115) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |
HMRbase accession number | 11144 |
Swiss-prot Accession number | P19209 (Sequence in FASTA format) |
Description | Somatostatin precursor [Contains: Somatostatin-34; Somatostatin-14](Fragment). |
Source organism | Myxine glutinosa (Atlantic hagfish) |
Taxonomical Classification | Eukaryota; Metazoa; Chordata; Craniata; Hyperotreti; Myxiniformes;Myxinidae; Myxininae; Myxine. |
Subcellular location | Secreted |
Developmental Stage | N/A |
Similarity | Belongs to the somatostatin family. |
Tissue Specificity | N/A |
Post translational modification | N/A |
Function | Somatostatin inhibits the release of somatotropin |
Protein Length | 34 Amino acids |
Molecular weight | 3963 |
References | 1 PubMed abstract 2896118 |
Domain Name | Somatostatin |
Hormone Name | Somatostatin-14 |
Mature Hormone Sequence | AGCKNFFWKTFTSC |
Position of mature hormone in Pre-Hormone protein | 14 Residues from position (21-34) |
Receptor | N/A |
Gene ID | N/A |
PDB ID | N/A |
Drugpedia | wiki |
Comments | !Receptor for this Hormone are either unknown or have not yet been curated |